General Information

  • ID:  hor000530
  • Uniprot ID:  A0A921ZJJ1
  • Protein name:  Helicostatin-6
  • Gene name:  NA
  • Organism:  Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Manduca (genus), Sphingini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  LPMYNFGL
  • Length:  8(118-125)
  • Propeptide:  MLSLLVPLWVVASALSVLSGALGEPERSGPVAAPAPPAALEKRSPHYDFGLGKRAYSYVPSVLVRPRQALGGGGSARGGYEVKRARPYSFGLGKRLAEDETSEEKRARMYDFGLGKRLPMYNFGLGKRAKSYNFGLGKRLSSKFNFGLGKRERDMNRFRFGLGKRSEGELPAAPAAAPADTDNYFDI
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000530_AF2.pdbhor000530_ESM.pdb

Physical Information

Mass: 107919 Formula: C46H67N9O11S
Absent amino acids: ACDEHIKQRSTVW Common amino acids: L
pI: 6.09 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: 68.75 Boman Index: 933
Half-Life / Aliphatic Index: 5.5 hour Aliphatic Index: 97.5
Instability Index: 3421.25 Extinction Coefficient cystines: 1490
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  14599724
  • Title:  A Comparison of the Neuropeptides From the Retrocerebral Complex of Adult Male and Female Manduca Sexta Using MALDI-TOF Mass Spectrometry